PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G00360.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 348aa    MW: 38648 Da    PI: 8.4063
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G00360.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.65e-392073007100
           DUF260   7 vlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      +lrr+C+++Cv+apyfpae++++fa+vh++FGasnv+k+l ++p+ +r+da+sslvyeA+ar+rdPvyG+v+ i+ lq+q++ql+ +lal+++e
  ORUFI11G00360.3 207 LLRRRCTSECVFAPYFPAEEAQRFAMVHRVFGASNVSKMLLDVPPPQRPDAVSSLVYEANARMRDPVYGCVAAISFLQNQVSQLQMQLALAHAE 300
                      68***************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.743200301IPR004883Lateral organ boundaries, LOB
PfamPF031957.4E-38207298IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MATAAAAGDG DEHLLSLFAS ALSHRSCLAM RYEALLLRQA KYSDDLHLQV SNEEWLTFAK  60
DSLDNGFYTI ASKAFANALL HIDPSHPGYL DSTNSILKKD KINDISGLQN LAKSLSARHS  120
VQAQSAEYMK RKASGVDEKC NLHLGKTKLP GSLMFRLGIK TRNIQKLRCS REKEACTATA  180
SNGGKRERER DTVRVVQAAA AAVHVGLLRR RCTSECVFAP YFPAEEAQRF AMVHRVFGAS  240
NVSKMLLDVP PPQRPDAVSS LVYEANARMR DPVYGCVAAI SFLQNQVSQL QMQLALAHAE  300
TAALQLQLQQ QHQDQDDHHH QQCILENAAA HHQLMLQEAF LKKESMWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417610.0AK241761.1 Oryza sativa Japonica Group cDNA, clone: J065205C18, full insert sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0004940.0BX000494.2 Oryza sativa chromosome 12, . BAC OSJNBa0052H10 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0004970.0BX000497.1 Oryza sativa chromosome 11, . BAC OSJNBa0010K05 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0R3520.0A0A0E0R352_ORYRU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-38LBD family protein